PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G1361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 382aa    MW: 43730.2 Da    PI: 6.6603
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G1361genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.76.5e-2873154286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li++rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Gh_A12G1361  73 WVQDETRSLIAIRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 154
                  ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-463134IPR009057Homeodomain-like
PROSITE profilePS500908.44465129IPR017877Myb-like domain
SMARTSM007173.9E-469131IPR001005SANT/Myb domain
CDDcd122031.05E-2971136No hitNo description
PfamPF138371.2E-2172156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MYLSEKPRSI DLYKEEGPAT ASDMIIEVTT NGDLPPHHHH HHHPPPQQQQ IILGESSCED  60
PEVKAPKKRA ETWVQDETRS LIAIRREMDG LFNTSKSNKH LWEQISAKMR EKGFDRSPTM  120
CTDKWRNLLK EFKKAKHQDR GSGSAKMSYY KEIEEILRER TKNAYKSPTP PPKVDSYMHF  180
ADKGFEDAGM SFGPVEASCR PILNLERRLD HEGHPLAVAA ADAVAASGVP PWNWRETPGN  240
GVDCQAYGGR VITVKFGEYT RRIGIDGSAD AIRDAIKSAF RLRTKRAFLL EDEDHIVHSL  300
DREMPLGNYT LHLDEGLPIK VCLYDESDHI PVHTEEKIFY VEDDYREYLL RRGYTGLREI  360
NGYRNVDNLD DLRTNAIYRG VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-5267152186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.3070.0boll| ovule| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8964131e-52KU896413.1 Hibiscus cannabinus microsatellite HC_ES_37_CTC sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438311.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D2T7360.0A0A0D2T736_G
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein